A1CF antibody (70R-4765)

Rabbit polyclonal A1CF antibody raised against the N terminal of A1CF

Synonyms Polyclonal A1CF antibody, Anti-A1CF antibody, APOBEC1CF antibody, ASP antibody, MGC163391 antibody, ACF64 antibody, ACF 1 antibody, ACF antibody, ACF 1, ACF65 antibody, Apobec1 Complementation Factor antibody, ACF-1 antibody, RP11-564C4.2 antibody, A1CF, ACF-1
Specificity A1CF antibody was raised against the N terminal of A1CF
Cross Reactivity Human
Applications WB
Immunogen A1CF antibody was raised using the N terminal of A1CF corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP
Assay Information A1CF Blocking Peptide, catalog no. 33R-2286, is also available for use as a blocking control in assays to test for specificity of this A1CF antibody

Images

Western Blot analysis using A1CF antibody (70R-4765)

A1CF antibody (70R-4765) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of A1CF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using A1CF antibody (70R-4765) | A1CF antibody (70R-4765) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors