A2BP1 antibody (70R-4783)

Rabbit polyclonal Ataxin 2-Binding Protein 1 antibody raised against the middle region of A2BP1

Synonyms Polyclonal A2BP1 antibody, Anti-A2BP1 antibody, Ataxin 2-Binding Protein 1 antibody
Specificity A2BP1 antibody was raised against the middle region of A2BP1
Cross Reactivity Human
Applications WB
Immunogen A2BP1 antibody was raised using the middle region of A2BP1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP
Assay Information A2BP1 Blocking Peptide, catalog no. 33R-8963, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody


Western Blot analysis using A2BP1 antibody (70R-4783)

A2BP1 antibody (70R-4783) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of A2BP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using A2BP1 antibody (70R-4783) | A2BP1 antibody (70R-4783) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors