AASDH antibody (70R-3281)

Rabbit polyclonal AASDH antibody raised against the middle region of AASDH

Synonyms Polyclonal AASDH antibody, Anti-AASDH antibody, LYS2 antibody, NRPS1098 antibody, Aminoadipate-Semialdehyde Dehydrogenase antibody, NRPS998 antibody, ACSF4 antibody
Specificity AASDH antibody was raised against the middle region of AASDH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AASDH antibody was raised using the middle region of AASDH corresponding to a region with amino acids TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL
Assay Information AASDH Blocking Peptide, catalog no. 33R-9009, is also available for use as a blocking control in assays to test for specificity of this AASDH antibody


Western Blot analysis using AASDH antibody (70R-3281)

AASDH antibody (70R-3281) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 122 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AASDH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AASDH antibody (70R-3281) | AASDH antibody (70R-3281) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors