ABHD5 antibody (70R-1266)

Rabbit polyclonal ABHD5 antibody raised against the N terminal of ABHD5

Synonyms Polyclonal ABHD5 antibody, Anti-ABHD5 antibody, CDS antibody, CGI58 antibody, MGC8731 antibody, NCIE2 antibody, Abhydrolase Domain Containing 5 antibody, IECN2 antibody
Specificity ABHD5 antibody was raised against the N terminal of ABHD5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ABHD5 antibody was raised using the N terminal of ABHD5 corresponding to a region with amino acids NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL
Assay Information ABHD5 Blocking Peptide, catalog no. 33R-6861, is also available for use as a blocking control in assays to test for specificity of this ABHD5 antibody

Western Blot analysis using ABHD5 antibody (70R-1266)

ABHD5 antibody (70R-1266) used at 5 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ABHD5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using ABHD5 antibody (70R-1266) | ABHD5 antibody (70R-1266) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors