ACADL antibody (70R-2510)

Rabbit polyclonal ACADL antibody raised against the middle region of ACADL

Synonyms Polyclonal ACADL antibody, Anti-ACADL antibody, ACAD4 antibody, Acyl-Coenzyme A Dehydrogenase Long Chain antibody, LCAD antibody
Specificity ACADL antibody was raised against the middle region of ACADL
Cross Reactivity Human,Mouse
Applications WB
Immunogen ACADL antibody was raised using the middle region of ACADL corresponding to a region with amino acids LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
Assay Information ACADL Blocking Peptide, catalog no. 33R-5283, is also available for use as a blocking control in assays to test for specificity of this ACADL antibody

Images

Western Blot analysis using ACADL antibody (70R-2510)

ACADL antibody (70R-2510) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACADL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACADL antibody (70R-2510) | ACADL antibody (70R-2510) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £300.47
Size: 50 ug
OR
Shipping
View Our Distributors