ACADM antibody (70R-1108)

Rabbit polyclonal ACADM antibody raised against the N terminal of ACADM

Synonyms Polyclonal ACADM antibody, Anti-ACADM antibody, Acyl-Coenzyme A Dehydrogenase C-4 To C-12 Straight Chain antibody
Specificity ACADM antibody was raised against the N terminal of ACADM
Cross Reactivity Human,Dog
Applications WB
Immunogen ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
Assay Information ACADM Blocking Peptide, catalog no. 33R-1549, is also available for use as a blocking control in assays to test for specificity of this ACADM antibody


Western Blot analysis using ACADM antibody (70R-1108)

ACADM antibody (70R-1108) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACADM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACADM antibody (70R-1108) | ACADM antibody (70R-1108) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors