ACADS antibody (70R-2485)

Rabbit polyclonal ACADS antibody raised against the N terminal of ACADS

Synonyms Polyclonal ACADS antibody, Anti-ACADS antibody, ACAD3 antibody, Acyl-Coenzyme A Dehydrogenase C-2 To C-3 Short Chain antibody, SCAD antibody
Specificity ACADS antibody was raised against the N terminal of ACADS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACADS antibody was raised using the N terminal of ACADS corresponding to a region with amino acids ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN
Assay Information ACADS Blocking Peptide, catalog no. 33R-1535, is also available for use as a blocking control in assays to test for specificity of this ACADS antibody


Western Blot analysis using ACADS antibody (70R-2485)

ACADS antibody (70R-2485) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACADS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACADS antibody (70R-2485) | ACADS antibody (70R-2485) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors