ACADSB antibody (70R-2531)

Rabbit polyclonal ACADSB antibody raised against the middle region of ACADSB

Synonyms Polyclonal ACADSB antibody, Anti-ACADSB antibody, 2-MEBCAD antibody, SBCAD antibody, Acyl-Coenzyme A Dehydrogenase Short/Branched Chain antibody, ACAD7 antibody
Specificity ACADSB antibody was raised against the middle region of ACADSB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG
Assay Information ACADSB Blocking Peptide, catalog no. 33R-3416, is also available for use as a blocking control in assays to test for specificity of this ACADSB antibody


Western Blot analysis using ACADSB antibody (70R-2531)

ACADSB antibody (70R-2531) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACADSB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACADSB antibody (70R-2531) | ACADSB antibody (70R-2531) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors