ACAT2 antibody (70R-1082)

Rabbit polyclonal ACAT2 antibody

Synonyms Polyclonal ACAT2 antibody, Anti-ACAT2 antibody, ACAT2, ACAT-2, ACAT 2 antibody, ACAT 2, ACAT-2 antibody, Acetyl-Coenzyme A Acetyltransferase 2 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
Assay Information ACAT2 Blocking Peptide, catalog no. 33R-8745, is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody


Immunohistochemical staining using ACAT2 antibody (70R-1082)

ACAT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human liver. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACAT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ACAT2 antibody (70R-1082) | ACAT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human liver. Magnification is at 400X
  • Western Blot analysis using ACAT2 antibody (70R-1082) | ACAT2 antibody (70R-1082) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £252.39
Size: 100 ug
View Our Distributors