ACBD3 antibody (70R-4016)

Rabbit polyclonal ACBD3 antibody raised against the N terminal of ACBD3

Synonyms Polyclonal ACBD3 antibody, Anti-ACBD3 antibody, ACBD 3 antibody, Acyl-Coenzyme A Binding Domain Containing 3 antibody, GOLPH1 antibody, ACBD-3 antibody, PAP7 antibody, ACBD3, GCP60 antibody, ACBD-3, ACBD 3, GOCAP1 antibody
Specificity ACBD3 antibody was raised against the N terminal of ACBD3
Cross Reactivity Human
Applications WB
Immunogen ACBD3 antibody was raised using the N terminal of ACBD3 corresponding to a region with amino acids EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL
Assay Information ACBD3 Blocking Peptide, catalog no. 33R-2282, is also available for use as a blocking control in assays to test for specificity of this ACBD3 antibody

Images

Western Blot analysis using ACBD3 antibody (70R-4016)

ACBD3 antibody (70R-4016) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACBD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACBD3 antibody (70R-4016) | ACBD3 antibody (70R-4016) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors