ACCN2 antibody (70R-5059)

Rabbit polyclonal ACCN2 antibody raised against the N terminal of ACCN2

Synonyms Polyclonal ACCN2 antibody, Anti-ACCN2 antibody, ACCN2, ASIC1A antibody, hBNaC2 antibody, ACCN-2, ASIC antibody, Amiloride-Sensitive Cation Channel 2 Neuronal antibody, BNaC2 antibody, ACCN 2, ACCN 2 antibody, ACCN-2 antibody
Specificity ACCN2 antibody was raised against the N terminal of ACCN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACCN2 antibody was raised using the N terminal of ACCN2 corresponding to a region with amino acids MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF
Assay Information ACCN2 Blocking Peptide, catalog no. 33R-5935, is also available for use as a blocking control in assays to test for specificity of this ACCN2 antibody


Western Blot analysis using ACCN2 antibody (70R-5059)

ACCN2 antibody (70R-5059) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACCN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACCN2 is the cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. ACCN2 is also permeable for Ca2+, Li+ and K+. ACCN2 generates a biphasic current with a fast inactivating and a slow sustained phase. ACCN2 mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACCN2 antibody (70R-5059) | ACCN2 antibody (70R-5059) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors