ACCN4 antibody (70R-5078)

Rabbit polyclonal ACCN4 antibody raised against the middle region of ACCN4

Synonyms Polyclonal ACCN4 antibody, Anti-ACCN4 antibody, ACCN4, ACCN-4, BNAC4 antibody, ASIC4 antibody, ACCN 4, ACCN 4 antibody, MGC17248 antibody, MGC24860 antibody, ACCN-4 antibody, Amiloride-Sensitive Cation Channel 4 Pituitary antibody
Specificity ACCN4 antibody was raised against the middle region of ACCN4
Cross Reactivity Human
Applications WB
Immunogen ACCN4 antibody was raised using the middle region of ACCN4 corresponding to a region with amino acids NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS
Assay Information ACCN4 Blocking Peptide, catalog no. 33R-6782, is also available for use as a blocking control in assays to test for specificity of this ACCN4 antibody


Western Blot analysis using ACCN4 antibody (70R-5078)

ACCN4 antibody (70R-5078) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACCN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACCN4 antibody (70R-5078) | ACCN4 antibody (70R-5078) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors