ACCN4 antibody (70R-5090)

Rabbit polyclonal ACCN4 antibody raised against the N terminal of ACCN4

Synonyms Polyclonal ACCN4 antibody, Anti-ACCN4 antibody, Amiloride-Sensitive Cation Channel 4 Pituitary antibody, ACCN4, ACCN-4 antibody, ACCN 4 antibody, ASIC4 antibody, BNAC4 antibody, MGC24860 antibody, MGC17248 antibody, ACCN-4, ACCN 4
Specificity ACCN4 antibody was raised against the N terminal of ACCN4
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA
Assay Information ACCN4 Blocking Peptide, catalog no. 33R-8696, is also available for use as a blocking control in assays to test for specificity of this ACCN4 antibody

Images

Western Blot analysis using ACCN4 antibody (70R-5090)

ACCN4 antibody (70R-5090) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACCN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACCN4 antibody (70R-5090) | ACCN4 antibody (70R-5090) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors