ACLY antibody (70R-3942)

Rabbit polyclonal ACLY antibody raised against the middle region of ACLY

Synonyms Polyclonal ACLY antibody, Anti-ACLY antibody, ACL antibody, Atp Citrate Lyase antibody, ATPCL antibody, CLATP antibody
Specificity ACLY antibody was raised against the middle region of ACLY
Cross Reactivity Human
Applications WB
Immunogen ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI
Assay Information ACLY Blocking Peptide, catalog no. 33R-8779, is also available for use as a blocking control in assays to test for specificity of this ACLY antibody


Western Blot analysis using ACLY antibody (70R-3942)

ACLY antibody (70R-3942) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 121 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACLY antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACLY antibody (70R-3942) | ACLY antibody (70R-3942) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors