ACO1 antibody (70R-4994)

Rabbit polyclonal ACO1 antibody raised against the N terminal of ACO1

Synonyms Polyclonal ACO1 antibody, Anti-ACO1 antibody, Aconitase 1 Soluble antibody
Specificity ACO1 antibody was raised against the N terminal of ACO1
Cross Reactivity Human, Rat
Applications IHC, WB
Immunogen ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
Assay Information ACO1 Blocking Peptide, catalog no. 33R-6475, is also available for use as a blocking control in assays to test for specificity of this ACO1 antibody

Images

Immunohistochemical staining using ACO1 antibody (70R-4994)

ACO1 antibody was used for immunohistochemistry at a concentration of 12.0 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 12 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ACO1 antibody (70R-4994) | ACO1 antibody was used for immunohistochemistry at a concentration of 12.0 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using ACO1 antibody (70R-4994) | ACO1 antibody (70R-4994) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors