ACRV1 antibody (70R-5307)

Rabbit polyclonal ACRV1 antibody raised against the N terminal of ACRV1

Synonyms Polyclonal ACRV1 antibody, Anti-ACRV1 antibody, SP-10 antibody, SPACA2 antibody, D11S4365 antibody, Acrosomal Vesicle Protein 1 antibody
Specificity ACRV1 antibody was raised against the N terminal of ACRV1
Cross Reactivity Human
Applications WB
Immunogen ACRV1 antibody was raised using the N terminal of ACRV1 corresponding to a region with amino acids MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS
Assay Information ACRV1 Blocking Peptide, catalog no. 33R-6263, is also available for use as a blocking control in assays to test for specificity of this ACRV1 antibody


Western Blot analysis using ACRV1 antibody (70R-5307)

ACRV1 antibody (70R-5307) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACRV1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACRV1 antibody (70R-5307) | ACRV1 antibody (70R-5307) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors