ADAMTS18 antibody (70R-4602)

Rabbit polyclonal ADAMTS18 antibody raised against the N terminal of ADAMTS18

Synonyms Polyclonal ADAMTS18 antibody, Anti-ADAMTS18 antibody, Adam Metallopeptidase With Thrombospondin Type 1 Motif 18 antibody, ADAMTS21 antibody
Specificity ADAMTS18 antibody was raised against the N terminal of ADAMTS18
Cross Reactivity Human,Mouse
Applications WB
Immunogen ADAMTS18 antibody was raised using the N terminal of ADAMTS18 corresponding to a region with amino acids FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS
Assay Information ADAMTS18 Blocking Peptide, catalog no. 33R-3140, is also available for use as a blocking control in assays to test for specificity of this ADAMTS18 antibody


Western Blot analysis using ADAMTS18 antibody (70R-4602)

ADAMTS18 antibody (70R-4602) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 104 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAMTS18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADAMTS18 antibody (70R-4602) | ADAMTS18 antibody (70R-4602) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors