ADAT1 antibody (70R-4703)

Rabbit polyclonal ADAT1 antibody raised against the C terminal of ADAT1

Synonyms Polyclonal ADAT1 antibody, Anti-ADAT1 antibody, Adenosine Deaminase tRNA-Specific 1 antibody, HADAT1 antibody
Specificity ADAT1 antibody was raised against the C terminal of ADAT1
Cross Reactivity Human
Applications IHC, WB
Immunogen ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV
Assay Information ADAT1 Blocking Peptide, catalog no. 33R-4947, is also available for use as a blocking control in assays to test for specificity of this ADAT1 antibody

Images

Immunohistochemical staining using ADAT1 antibody (70R-4703)

ADAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ADAT1 antibody (70R-4703) | ADAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X
  • Western Blot analysis using ADAT1 antibody (70R-4703) | ADAT1 antibody (70R-4703) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors