Adducin beta 2 antibody (70R-2193)

Rabbit polyclonal Adducin beta 2 antibody

Synonyms Polyclonal Adducin beta 2 antibody, Anti-Adducin beta 2 antibody, ADDB antibody, ADDB2 antibody
Cross Reactivity Human
Applications WB
Immunogen Adducin beta 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS
Assay Information Adducin beta 2 Blocking Peptide, catalog no. 33R-9887, is also available for use as a blocking control in assays to test for specificity of this Adducin beta 2 antibody


Western Blot analysis using Adducin beta 2 antibody (70R-2193)

Adducin beta 2 antibody (70R-2193) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Adducin beta 2 antibody (70R-2193) | Adducin beta 2 antibody (70R-2193) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors