ADH1B antibody (70R-3920)

Rabbit polyclonal ADH1B antibody

Synonyms Polyclonal ADH1B antibody, Anti-ADH1B antibody, Alcohol Dehydrogenase 1B antibody, DKFZp686C06125 antibody, ADH2 antibody, Alcohol Dehydrogenase Class I beta polypeptide antibody
Cross Reactivity Human
Applications WB
Immunogen ADH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD
Assay Information ADH1B Blocking Peptide, catalog no. 33R-8864, is also available for use as a blocking control in assays to test for specificity of this ADH1B antibody

Images

Western Blot analysis using ADH1B antibody (70R-3920)

ADH1B antibody (70R-3920) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADH1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADH1B antibody (70R-3920) | ADH1B antibody (70R-3920) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors