ADHFE1 antibody (70R-3710)

Rabbit polyclonal ADHFE1 antibody raised against the middle region of ADHFE1

Synonyms Polyclonal ADHFE1 antibody, Anti-ADHFE1 antibody, ADH8 antibody, Alcohol Dehydrogenase Iron Containing 1 antibody, HMFT2263 antibody, MGC48605 antibody, FLJ32430 antibody, HOT antibody
Specificity ADHFE1 antibody was raised against the middle region of ADHFE1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS
Assay Information ADHFE1 Blocking Peptide, catalog no. 33R-7987, is also available for use as a blocking control in assays to test for specificity of this ADHFE1 antibody


Western Blot analysis using ADHFE1 antibody (70R-3710)

ADHFE1 antibody (70R-3710) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADHFE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADHFE1 is hydroxyacid-oxoacid transhydrogenase, which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADHFE1 antibody (70R-3710) | ADHFE1 antibody (70R-3710) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors