ADSSL1 antibody (70R-4108)

Rabbit polyclonal ADSSL1 antibody raised against the middle region of ADSSL1

Synonyms Polyclonal ADSSL1 antibody, Anti-ADSSL1 antibody, Adenylosuccinate Synthase Like 1 antibody, FLJ38602 antibody
Specificity ADSSL1 antibody was raised against the middle region of ADSSL1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ADSSL1 antibody was raised using the middle region of ADSSL1 corresponding to a region with amino acids VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS
Assay Information ADSSL1 Blocking Peptide, catalog no. 33R-9461, is also available for use as a blocking control in assays to test for specificity of this ADSSL1 antibody


Western Blot analysis using ADSSL1 antibody (70R-4108)

ADSSL1 antibody (70R-4108) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADSSL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADSSL1 is a muscle isozyme of adenylosuccinate synthase (EC, which catalyzes the initial reaction in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADSSL1 antibody (70R-4108) | ADSSL1 antibody (70R-4108) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors