Afamin antibody (70R-5299)

Rabbit polyclonal Afamin antibody raised against the middle region of AFM

Synonyms Polyclonal Afamin antibody, Anti-Afamin antibody, AFM antibody
Specificity Afamin antibody was raised against the middle region of AFM
Cross Reactivity Human
Applications WB
Immunogen Afamin antibody was raised using the middle region of AFM corresponding to a region with amino acids GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
Assay Information Afamin Blocking Peptide, catalog no. 33R-3492, is also available for use as a blocking control in assays to test for specificity of this Afamin antibody


Western Blot analysis using Afamin antibody (70R-5299)

Afamin antibody (70R-5299) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AFM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Afamin antibody (70R-5299) | Afamin antibody (70R-5299) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors