AGGF1 antibody (70R-3986)

Rabbit polyclonal AGGF1 antibody raised against the middle region of AGGF1

Synonyms Polyclonal AGGF1 antibody, Anti-AGGF1 antibody, FLJ10283 antibody, GPATC7 antibody, HUS84971 antibody, GPATCH7 antibody, VG5Q antibody, HSU84971 antibody, Angiogenic Factor With G Patch And Fha Domains 1 antibody
Specificity AGGF1 antibody was raised against the middle region of AGGF1
Cross Reactivity Human
Applications WB
Immunogen AGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR
Assay Information AGGF1 Blocking Peptide, catalog no. 33R-2818, is also available for use as a blocking control in assays to test for specificity of this AGGF1 antibody


Western Blot analysis using AGGF1 antibody (70R-3986)

AGGF1 antibody (70R-3986) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGGF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AGGF1 antibody (70R-3986) | AGGF1 antibody (70R-3986) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors