AGXT2 antibody (70R-5302)

Rabbit polyclonal AGXT2 antibody raised against the N terminal of AGXT2

Synonyms Polyclonal AGXT2 antibody, Anti-AGXT2 antibody, Alanine-Glyoxylate Aminotransferase 2 antibody, AGT2 antibody
Specificity AGXT2 antibody was raised against the N terminal of AGXT2
Cross Reactivity Human
Applications WB
Immunogen AGXT2 antibody was raised using the N terminal of AGXT2 corresponding to a region with amino acids TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK
Assay Information AGXT2 Blocking Peptide, catalog no. 33R-9305, is also available for use as a blocking control in assays to test for specificity of this AGXT2 antibody


Western Blot analysis using AGXT2 antibody (70R-5302)

AGXT2 antibody (70R-5302) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGXT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AGXT2 antibody (70R-5302) | AGXT2 antibody (70R-5302) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors