AHNAK2 antibody (70R-3905)

Rabbit polyclonal AHNAK2 antibody raised against the middle region of AHNAK2

Synonyms Polyclonal AHNAK2 antibody, Anti-AHNAK2 antibody, Ahnak Nucleoprotein 2 antibody
Specificity AHNAK2 antibody was raised against the middle region of AHNAK2
Cross Reactivity Human
Applications WB
Immunogen AHNAK2 antibody was raised using the middle region of AHNAK2 corresponding to a region with amino acids AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP
Assay Information AHNAK2 Blocking Peptide, catalog no. 33R-1056, is also available for use as a blocking control in assays to test for specificity of this AHNAK2 antibody


Western Blot analysis using AHNAK2 antibody (70R-3905)

AHNAK2 antibody (70R-3905) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AHNAK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of AHNAK2 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AHNAK2 antibody (70R-3905) | AHNAK2 antibody (70R-3905) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors