AKAP7 antibody (70R-1065)

Rabbit polyclonal AKAP7 antibody

Synonyms Polyclonal AKAP7 antibody, Anti-AKAP7 antibody, A-kinase anchoring protein 7 antibody, Prka Anchor Protein 7 antibody, AKAP18 antibody
Cross Reactivity Human
Applications WB
Immunogen AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN
Assay Information AKAP7 Blocking Peptide, catalog no. 33R-6152, is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody


Western Blot analysis using AKAP7 antibody (70R-1065)

AKAP7 antibody (70R-1065) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AKAP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AKAP7 antibody (70R-1065) | AKAP7 antibody (70R-1065) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors