AKTIP antibody (70R-2220)

Rabbit polyclonal AKTIP antibody raised against the middle region of AKTIP

Synonyms Polyclonal AKTIP antibody, Anti-AKTIP antibody, FTS antibody, Akt Interacting Protein antibody, FT1 antibody
Specificity AKTIP antibody was raised against the middle region of AKTIP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
Assay Information AKTIP Blocking Peptide, catalog no. 33R-6833, is also available for use as a blocking control in assays to test for specificity of this AKTIP antibody

Images

Western Blot analysis using AKTIP antibody (70R-2220)

AKTIP antibody (70R-2220) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKTIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AKTIP antibody (70R-2220) | AKTIP antibody (70R-2220) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors