ALAD antibody (70R-3446)

Rabbit polyclonal ALAD antibody raised against the middle region of ALAD

Synonyms Polyclonal ALAD antibody, Anti-ALAD antibody, MGC5057 antibody, Aminolevulinate Delta- Dehydratase antibody, ALADH antibody
Specificity ALAD antibody was raised against the middle region of ALAD
Cross Reactivity Human
Applications WB
Immunogen ALAD antibody was raised using the middle region of ALAD corresponding to a region with amino acids SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
Assay Information ALAD Blocking Peptide, catalog no. 33R-8920, is also available for use as a blocking control in assays to test for specificity of this ALAD antibody

Images

Western Blot analysis using ALAD antibody (70R-3446)

ALAD antibody (70R-3446) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALAD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALAD antibody (70R-3446) | ALAD antibody (70R-3446) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors