ALAS2 antibody (70R-1101)

Rabbit polyclonal ALAS2 antibody

Synonyms Polyclonal ALAS2 antibody, Anti-ALAS2 antibody, ANH1 antibody, PRO2399 antibody, Aminolevulinate Delta- Synthase 2 antibody, Sideroblastic/Hypochromic Anemia antibody, ASB antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen ALAS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ
Assay Information ALAS2 Blocking Peptide, catalog no. 33R-9531, is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody


Immunohistochemical staining using ALAS2 antibody (70R-1101)

ALAS2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ALAS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ALAS2 antibody (70R-1101) | ALAS2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using ALAS2 antibody (70R-1101) | ALAS2 antibody (70R-1101) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors