ALDOB antibody (70R-2209)

Rabbit polyclonal ALDOB antibody raised against the middle region of ALDOB

Synonyms Polyclonal ALDOB antibody, Anti-ALDOB antibody, ALDB antibody, Aldolase B Fructose-Bisphosphate antibody
Specificity ALDOB antibody was raised against the middle region of ALDOB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ
Assay Information ALDOB Blocking Peptide, catalog no. 33R-4503, is also available for use as a blocking control in assays to test for specificity of this ALDOB antibody

Western Blot analysis using ALDOB antibody (70R-2209)

ALDOB antibody (70R-2209) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDOB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fructose-1,6-bisphosphate aldolase (EC is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using ALDOB antibody (70R-2209) | ALDOB antibody (70R-2209) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors