ALKBH3 antibody (70R-3704)

Rabbit polyclonal ALKBH3 antibody

Synonyms Polyclonal ALKBH3 antibody, Anti-ALKBH3 antibody, PCA1 antibody, MGC118793 antibody, ABH3 antibody, MGC118792 antibody, DEPC1 antibody, Alkb Alkylation Repair Homolog 3 antibody, MGC118790 antibody, DEPC-1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS
Assay Information ALKBH3 Blocking Peptide, catalog no. 33R-2593, is also available for use as a blocking control in assays to test for specificity of this ALKBH3 antibody


Western blot analysis using ALKBH3 antibody (70R-3704)

Recommended ALKBH3 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALKBH3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using ALKBH3 antibody (70R-3704) | Recommended ALKBH3 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors