ALS2 antibody (70R-3555)

Rabbit polyclonal ALS2 antibody

Synonyms Polyclonal ALS2 antibody, Anti-ALS2 antibody, FLJ31851 antibody, MGC87187 antibody, IAHSP antibody, ALS2CR6 antibody, ALSJ antibody, Amyotrophic Lateral Sclerosis 2 antibody, PLSJ antibody, KIAA1563 antibody
Cross Reactivity Human
Applications WB
Immunogen ALS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSG
Assay Information ALS2 Blocking Peptide, catalog no. 33R-1366, is also available for use as a blocking control in assays to test for specificity of this ALS2 antibody


Western Blot analysis using ALS2 antibody (70R-3555)

ALS2 antibody (70R-3555) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 184 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene contains an ATS1/RCC1-like domain, a RhoGEF domain, and a vacuolar protein sorting 9 (VPS9) domain, all of which are guanine-nucleotide exchange factors that activate members of the Ras superfamily of GTPases. The protein functions as a guanine nucleotide exchange factor for the small GTPase RAB5. The protein localizes with RAB5 on early endosomal compartments, and functions as a modulator for endosomal dynamics. Mutations in this gene result in several forms of juvenile lateral sclerosis and infantile-onset ascending spastic paralysis. Multiple transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALS2 antibody (70R-3555) | ALS2 antibody (70R-3555) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors