AMD1 antibody (70R-2634)

Rabbit polyclonal AMD1 antibody raised against the N terminal of AMD1

Synonyms Polyclonal AMD1 antibody, Anti-AMD1 antibody, ADOMETDC antibody, DKFZp313L1234 antibody, AMD antibody, Adenosylmethionine Decarboxylase 1 antibody, FLJ26964 antibody
Specificity AMD1 antibody was raised against the N terminal of AMD1
Cross Reactivity Human,Mouse
Applications WB
Immunogen AMD1 antibody was raised using the N terminal of AMD1 corresponding to a region with amino acids MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV
Assay Information AMD1 Blocking Peptide, catalog no. 33R-6068, is also available for use as a blocking control in assays to test for specificity of this AMD1 antibody

Images

Western Blot analysis using AMD1 antibody (70R-2634)

AMD1 antibody (70R-2634) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AMD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of AMD1 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AMD1 antibody (70R-2634) | AMD1 antibody (70R-2634) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors