AMFR antibody (70R-1149)

Rabbit polyclonal AMFR antibody raised against the C terminal of AMFR

Synonyms Polyclonal AMFR antibody, Anti-AMFR antibody, Autocrine Motility Factor Receptor antibody, RNF45 antibody, GP78 antibody
Specificity AMFR antibody was raised against the C terminal of AMFR
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK
Assay Information AMFR Blocking Peptide, catalog no. 33R-2901, is also available for use as a blocking control in assays to test for specificity of this AMFR antibody


Western Blot analysis using AMFR antibody (70R-1149)

AMFR antibody (70R-1149) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AMFR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AMFR antibody (70R-1149) | AMFR antibody (70R-1149) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors