AMN1 antibody (70R-4424)

Rabbit polyclonal AMN1 antibody

Synonyms Polyclonal AMN1 antibody, Anti-AMN1 antibody, Antagonist Of Mitotic Exit Network 1 Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen AMN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT
Assay Information AMN1 Blocking Peptide, catalog no. 33R-7333, is also available for use as a blocking control in assays to test for specificity of this AMN1 antibody


Western Blot analysis using AMN1 antibody (70R-4424)

AMN1 antibody (70R-4424) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AMN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AMN1 antibody (70R-4424) | AMN1 antibody (70R-4424) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors