ANKRD13B antibody (70R-3642)

Rabbit polyclonal ANKRD13B antibody raised against the middle region of ANKRD13B

Synonyms Polyclonal ANKRD13B antibody, Anti-ANKRD13B antibody, FLJ25555 antibody, Ankyrin Repeat Domain 13B antibody, FLJ20418 antibody
Specificity ANKRD13B antibody was raised against the middle region of ANKRD13B
Cross Reactivity Human,Rat
Applications WB
Immunogen ANKRD13B antibody was raised using the middle region of ANKRD13B corresponding to a region with amino acids HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ
Assay Information ANKRD13B Blocking Peptide, catalog no. 33R-3814, is also available for use as a blocking control in assays to test for specificity of this ANKRD13B antibody

Images

Western Blot analysis using ANKRD13B antibody (70R-3642)

ANKRD13B antibody (70R-3642) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD13B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ANKRD13B protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANKRD13B antibody (70R-3642) | ANKRD13B antibody (70R-3642) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors