ANKRD2 antibody (70R-3378)

Rabbit polyclonal ANKRD2 antibody

Synonyms Polyclonal ANKRD2 antibody, Anti-ANKRD2 antibody, MGC104314 antibody, Stretch Responsive Muscle antibody, Ankyrin Repeat Domain 2 antibody, ARPP antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL
Assay Information ANKRD2 Blocking Peptide, catalog no. 33R-7516, is also available for use as a blocking control in assays to test for specificity of this ANKRD2 antibody

Images

Western Blot analysis using ANKRD2 antibody (70R-3378)

ANKRD2 antibody (70R-3378) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANKRD2 may play an important role in skeletal muscle hypertrophy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANKRD2 antibody (70R-3378) | ANKRD2 antibody (70R-3378) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors