ANKRD47 antibody (70R-4426)

Rabbit polyclonal ANKRD47 antibody raised against the N terminal Of Ankrd47

Synonyms Polyclonal ANKRD47 antibody, Anti-ANKRD47 antibody, Ankyrin Repeat Domain 47 antibody, FLJ46061 antibody
Specificity ANKRD47 antibody was raised against the N terminal Of Ankrd47
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLK
Assay Information ANKRD47 Blocking Peptide, catalog no. 33R-5677, is also available for use as a blocking control in assays to test for specificity of this ANKRD47 antibody


Western Blot analysis using ANKRD47 antibody (70R-4426)

ANKRD47 antibody (70R-4426) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD47 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ANKRD47 antibody (70R-4426) | ANKRD47 antibody (70R-4426) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors