ANKRD5 antibody (70R-3386)

Rabbit polyclonal ANKRD5 antibody raised against the middle region of ANKRD5

Synonyms Polyclonal ANKRD5 antibody, Anti-ANKRD5 antibody, Ankyrin Repeat Domain 5 antibody, dJ839B4.6 antibody, FLJ21669 antibody
Specificity ANKRD5 antibody was raised against the middle region of ANKRD5
Cross Reactivity Human
Applications WB
Immunogen ANKRD5 antibody was raised using the middle region of ANKRD5 corresponding to a region with amino acids LDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK
Assay Information ANKRD5 Blocking Peptide, catalog no. 33R-4846, is also available for use as a blocking control in assays to test for specificity of this ANKRD5 antibody


Western Blot analysis using ANKRD5 antibody (70R-3386)

ANKRD5 antibody (70R-3386) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ANKRD5 antibody (70R-3386) | ANKRD5 antibody (70R-3386) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors