Annexin A2 antibody (70R-1679)

Rabbit polyclonal Annexin A2 antibody raised against the C terminal of ANXA2

Synonyms Polyclonal Annexin A2 antibody, Anti-Annexin A2 antibody, Annexin A 2, Annexin A2, Annexin A-2, Annexin A-2 antibody, ANXA2 antibody, Annexin A 2 antibody
Specificity Annexin A2 antibody was raised against the C terminal of ANXA2
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
Assay Information Annexin A2 Blocking Peptide, catalog no. 33R-7972, is also available for use as a blocking control in assays to test for specificity of this Annexin A2 antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £252.39
Size: 100 ug
OR
Shipping
View Our Distributors