Annexin A3 antibody (70R-1678)

Rabbit polyclonal Annexin A3 antibody raised against the C terminal of ANXA3

Synonyms Polyclonal Annexin A3 antibody, Anti-Annexin A3 antibody, Annexin A-3 antibody, Annexin A 3, Annexin A3, Annexin A 3 antibody, ANXA3 antibody, Annexin A-3
Specificity Annexin A3 antibody was raised against the C terminal of ANXA3
Cross Reactivity Human,Dog
Applications WB
Immunogen Annexin A3 antibody was raised using the C terminal of ANXA3 corresponding to a region with amino acids RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD
Assay Information Annexin A3 Blocking Peptide, catalog no. 33R-7970, is also available for use as a blocking control in assays to test for specificity of this Annexin A3 antibody


Western Blot analysis using Annexin A3 antibody (70R-1678)

Annexin A3 antibody (70R-1678) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, ANXA3, encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Annexin A3 antibody (70R-1678) | Annexin A3 antibody (70R-1678) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors