Annexin A4 antibody (70R-1676)

Rabbit polyclonal Annexin A4 antibody raised against the N terminal of ANXA4

Synonyms Polyclonal Annexin A4 antibody, Anti-Annexin A4 antibody, ANX4 antibody, MGC75105 antibody, Annexin A 4, Annexin A-4 antibody, PIG28 antibody, Annexin A-4, ANXA4 antibody, DKFZp686H02120 antibody, Annexin A 4 antibody, Annexin A4
Specificity Annexin A4 antibody was raised against the N terminal of ANXA4
Cross Reactivity Human,Rat,Dog
Applications IHC, WB
Immunogen Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Assay Information Annexin A4 Blocking Peptide, catalog no. 33R-3396, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody


Immunohistochemical staining using Annexin A4 antibody (70R-1676)

Annexin A4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (lndicated with Arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Annexin A4 antibody (70R-1676) | Annexin A4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (lndicated with Arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using Annexin A4 antibody (70R-1676) | Annexin A4 antibody (70R-1676) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors