ANP32A antibody (70R-1646)

Rabbit polyclonal ANP32A antibody

Synonyms Polyclonal ANP32A antibody, Anti-ANP32A antibody, Acidic Nuclear Phosphoprotein 32A antibody, Leucine-Rich Nuclear Phosphoprotein 32 Family A antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen ANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTI
Assay Information ANP32A Blocking Peptide, catalog no. 33R-5937, is also available for use as a blocking control in assays to test for specificity of this ANP32A antibody

Images

Immunohistochemical staining using ANP32A antibody (70R-1646)

ANP32A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANP32A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ANP32A antibody (70R-1646) | ANP32A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X
  • Western Blot analysis using ANP32A antibody (70R-1646) | ANP32A antibody (70R-1646) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors