AP3M2 antibody (70R-3582)

Rabbit polyclonal AP3M2 antibody raised against the middle region of AP3M2

Synonyms Polyclonal AP3M2 antibody, Anti-AP3M2 antibody, AP3, P47B antibody, AP47B antibody, CLA20 antibody, AP-3 antibody, AP 3, AP-3, AP 3 antibody, Adaptor-Related Protein Complex 3 Mu 2 Subunit antibody
Specificity AP3M2 antibody was raised against the middle region of AP3M2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AP3M2 antibody was raised using the middle region of AP3M2 corresponding to a region with amino acids VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID
Assay Information AP3M2 Blocking Peptide, catalog no. 33R-9888, is also available for use as a blocking control in assays to test for specificity of this AP3M2 antibody


Western Blot analysis using AP3M2 antibody (70R-3582)

AP3M2 antibody (70R-3582) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AP3M2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AP3M2 antibody (70R-3582) | AP3M2 antibody (70R-3582) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors