APIP antibody (70R-4451)

Rabbit polyclonal APIP antibody raised against the middle region of APIP

Synonyms Polyclonal APIP antibody, Anti-APIP antibody, dJ179L10.2 antibody, Apaf1 Interacting Protein antibody, MMRP19 antibody, CGI-29 antibody, APIP2 antibody
Specificity APIP antibody was raised against the middle region of APIP
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen APIP antibody was raised using the middle region of APIP corresponding to a region with amino acids GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV
Assay Information APIP Blocking Peptide, catalog no. 33R-3330, is also available for use as a blocking control in assays to test for specificity of this APIP antibody

Images

Western Blot analysis using APIP antibody (70R-4451)

APIP antibody (70R-4451) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using APIP antibody (70R-4451) | APIP antibody (70R-4451) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors