ApoA-II antibody (70R-3980)

Rabbit polyclonal ApoA-II antibody raised against the N terminal of APOA2

Synonyms Polyclonal ApoA-II antibody, Anti-ApoA-II antibody, Apo AII antibody, ApoA2 antibody, ApoA2 antibody, Apolipoprotein A-Ii antibody, Apolipoprotein A ll antibody
Specificity ApoA-II antibody was raised against the N terminal of APOA2
Cross Reactivity Human
Applications WB
Immunogen ApoA-II antibody was raised using the N terminal of APOA2 corresponding to a region with amino acids MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Assay Information ApoA-II Blocking Peptide, catalog no. 33R-6151, is also available for use as a blocking control in assays to test for specificity of this ApoA-II antibody


Western Blot analysis using ApoA-II antibody (70R-3980)

ApoA-II antibody (70R-3980) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ApoA-II antibody (70R-3980) | ApoA-II antibody (70R-3980) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors