ApoBEC3D antibody (70R-4868)

Rabbit polyclonal ApoBEC3D antibody

Synonyms Polyclonal ApoBEC3D antibody, Anti-ApoBEC3D antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 3D antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen ApoBEC3D antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE
Assay Information ApoBEC3D Blocking Peptide, catalog no. 33R-8959, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3D antibody

Images

Immunohistochemical staining using ApoBEC3D antibody (70R-4868)

ApoBEC3D antibody was used for immunohistochemistry at a concentration of 12.0 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC3D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 12 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ApoBEC3D antibody (70R-4868) | ApoBEC3D antibody was used for immunohistochemistry at a concentration of 12.0 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using ApoBEC3D antibody (70R-4868) | ApoBEC3D antibody (70R-4868) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors