Aquaporin 7 antibody (70R-2319)

Rabbit polyclonal Aquaporin 7 antibody raised against the C terminal of AQP7

Synonyms Polyclonal Aquaporin 7 antibody, Anti-Aquaporin 7 antibody, AQP7 antibody, AQPA_HUMAN antibody
Specificity Aquaporin 7 antibody was raised against the C terminal of AQP7
Cross Reactivity Human
Applications WB
Immunogen Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA
Assay Information Aquaporin 7 Blocking Peptide, catalog no. 33R-2182, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 7 antibody


Western Blot analysis using Aquaporin 7 antibody (70R-2319)

Aquaporin 7 antibody (70R-2319) used at 0.4 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AQP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.4 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Aquaporin 7 antibody (70R-2319) | Aquaporin 7 antibody (70R-2319) used at 0.4 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors