ARHGAP28 antibody (70R-3328)

Rabbit polyclonal ARHGAP28 antibody raised against the C terminal of ARHGAP28

Synonyms Polyclonal ARHGAP28 antibody, Anti-ARHGAP28 antibody, DKFZp686A2038 antibody, Rho Gtpase Activating Protein 28 antibody, FLJ10312 antibody
Specificity ARHGAP28 antibody was raised against the C terminal of ARHGAP28
Cross Reactivity Human
Applications WB
Immunogen ARHGAP28 antibody was raised using the C terminal of ARHGAP28 corresponding to a region with amino acids AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD
Assay Information ARHGAP28 Blocking Peptide, catalog no. 33R-1293, is also available for use as a blocking control in assays to test for specificity of this ARHGAP28 antibody


Western Blot analysis using ARHGAP28 antibody (70R-3328)

ARHGAP28 antibody (70R-3328) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARHGAP28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ARHGAP28 antibody (70R-3328) | ARHGAP28 antibody (70R-3328) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors